Product Specification
| Product Type |
Peptides |
|
|---|---|---|
 |
||
| Cat Number |
CLP1406 |
|
| Product Name |
PACAP (1-27)，human，ovine，rat |
|
| CAS Number |
127317-03-7 |
|
| Sequence(1 LC) |
HSDGIFTDSYSRYRKQMAVKKYLAAVL-NH2 |
|
| Sequence(3 LC) |
His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-NH2 |
|
| Synonyms |
PACAP 1-27 |
|
| Molecular Formula |
C142H224N40O39S1 |
|
| Molecular Weight |
3147.66 |
|
| Purity |
≥95% |
|
| Appearance |
Lyophilized powder |
|
| Salt system |
Trifluoroacetate salt |
|
| Source |
Synthetic |
|
| Storage |
Store at -20℃，2 years.(Avoid freeze/thaw cycles) |
|
| Solubility |
DMSO：100 mg/mL; |
|
|
||
| Note |
Please allow the product to equilibrate to room temperature in a dry environment before opening the packaging. |
|