Product Specification
| Product Type |
Peptides |
|
|---|---|---|
 |
||
| Cat Number |
CLP1584 |
|
| Product Name |
PHI-27 (porcine) |
|
| CAS Number |
80458-29-3 |
|
| Sequence(1 LC) |
HADGVFTSDFSRLLGQLSAKKYLESLI-NH2 |
|
| Sequence(3 LC) |
His-Ala-Asp-Gly-Val-Phe-Thr-Ser-Asp-Phe-Ser-Arg-Leu-Leu-Gly-Gln-Leu-Ser-Ala-Lys-Lys-Tyr-Leu-Glu-Ser-Leu-Ile-NH2 |
|
| Molecular Formula |
C136H216N36O40 |
|
| Molecular Weight |
2995.39 |
|
| Purity |
≥95% |
|
| Appearance |
Lyophilized powder |
|
| Salt system |
Trifluoroacetate salt |
|
| Source |
Synthetic |
|
| Storage |
Store at -20℃，2 years.(Avoid freeze/thaw cycles) |
|
|
||
| Note |
Please allow the product to equilibrate to room temperature in a dry environment before opening the packaging. |
|