Product Type |
Peptides |
|
---|---|---|
Cat Number |
CLP1585 |
|
Product Name |
PHI-27 (rat) |
|
CAS Number |
96849-38-6 |
|
Sequence(1 LC) |
HADGVFTSDYSRLLGQISAKKYLESLI-NH2 |
|
Sequence(3 LC) |
His-Ala-Asp-Gly-Val-Phe-Thr-Ser-Asp-Tyr-Ser-Arg-Leu-Leu-Gly-Gln-Ile-Ser-Ala-Lys-Lys-Tyr-Leu-Glu-Ser-Leu-Ile-NH2 |
|
Molecular Formula |
C136H216N36O41 |
|
Molecular Weight |
3011.44 |
|
Purity |
≥95% |
|
Appearance |
Lyophilized powder |
|
Salt system |
Trifluoroacetate salt |
|
Source |
Synthetic |
|
Storage |
Store at -20℃,2 years.(Avoid freeze/thaw cycles) |
|
Note |
Please allow the product to equilibrate to room temperature in a dry environment before opening the packaging. |