Product Specification
| Product Type |
Peptides |
|
|---|---|---|
 |
||
| Cat Number |
CLP1879 |
|
| Product Name |
Exendin(9-39) amide |
|
| CAS Number |
133514-43-9 |
|
| Sequence(1 LC) |
DLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2 |
|
| Sequence(3 LC) |
Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2 |
|
| Molecular Formula |
C149H234N40O47S |
|
| Molecular Weight |
3369.76 |
|
| Purity |
≥95.0% |
|
| Appearance |
Lyophilized powder |
|
| Salt system |
Trifluoroacetate salt |
|
| Source |
Synthetic |
|
| Storage |
Store at -20℃，2 years.(Avoid freeze/thaw cycles) |
|
| Solubility |
Continuous subcutaneous infusion of Avexitide (Exendin (9-39)) significantly raises fasting blood glucose levels in SUR-1 -/- mice without affecting glucose tolerance. |
|
|
||
| Note |
Please allow the product to equilibrate to room temperature in a dry environment before opening the packaging. |
|