Product Specification
| Product Type |
Peptides |
|
|---|---|---|
 |
||
| Cat Number |
CLP0485 |
|
| Product Name |
Prolactin-Releasing Peptide (1-31), human |
|
| CAS Number |
215510-22-8 |
|
| Sequence(1 LC) |
SRTHRHSMEIRTPDINPAWYASRGIRPVGRF-NH2 |
|
| Sequence(3 LC) |
Ser-Arg-Thr-His-Arg-His-Ser-Met-Glu-Ile-Arg-Thr-Pro-Asp-Ile-Asn-Pro-Ala-Trp-Tyr-Ala-Ser-Arg-Gly-Ile-Arg-Pro-Val-Gly-Arg-Phe-NH2 |
|
| Synonyms |
PrRP31 (human) |
|
| Molecular Formula |
C160H252N56O42S1 |
|
| Molecular Weight |
3664.18 |
|
| Purity |
≥95% |
|
| Appearance |
Lyophilized powder |
|
| Salt system |
Trifluoroacetate salt |
|
| Source |
Synthetic |
|
| Storage |
Store at -20℃，2 years.(Avoid freeze/thaw cycles) |
|
| Solubility |
DMSO：12.5 mg/mL; |
|
|
||
| Note |
Please allow the product to equilibrate to room temperature in a dry environment before opening the packaging. |
|