Nocistatin(human)
Cat.No:CLP1577 Solarbio
CAS:212609-11-5
Molecular Formula:C149H238N42O53S3
Molecular Weight:3561.93
Purity:≥95%
Appearance:Lyophilized powder
Storage:Store at -20℃,2 years.(Avoid freeze/thaw cycles)
Qty:
Size:
{{cart_num}}
My CartCAS:212609-11-5
Molecular Formula:C149H238N42O53S3
Molecular Weight:3561.93
Purity:≥95%
Appearance:Lyophilized powder
Storage:Store at -20℃,2 years.(Avoid freeze/thaw cycles)
Qty:
Size:
Product Type | Peptides |
CAS | 212609-11-5 |
Sequence(1LC) | MPRVRSLFQEQEEPEPGMEEAGEMEQKQLQ |
Sequence(3LC) | Met-Pro-Arg-Val-Arg-Ser-Leu-Phe-Gln-Glu-Gln-Glu-Glu-Pro-Glu-Pro-Gly-Met-Glu-Glu-Ala-Gly-Glu-Met-Glu-Gln-Lys-Gln-Leu-Gln |
Molecular Formula | C149H238N42O53S3 |
Molecular Weight | 3561.93 |
Purity | ≥95% |
Appearance | Lyophilized powder |
Salt Form | Trifluoroacetate salt |
Source | Synthetic |
Storage | Store at -20℃,2 years.(Avoid freeze/thaw cycles) |
Category/Label | Hormone and Related Peptides |
Background | Nocistatin (human) blocks nociceptin-induced allodynia and hyperalgesia, and attenuates pain evoked by prostaglandin E2. |
Reference | [1]. E Okuda-Ashitaka, et al. Nocistatin, a peptide that blocks nociceptin action in pain transmission. Nature. 1998 Mar 19;392(6673):286-9. [2]. M Hiramatsu, et al. Effects of nocistatin on nociceptin-induced impairment of learning and memory in mice. Eur J Pharmacol. 1999 Feb 19;367(2-3):151-5. |
Unit | Bottle |
Specification | 1mg 5mg |
Remark:These protocols are for reference only. Solarbio does not independently validate these methods.
Note:
1. The products are all for scientific research use only. Do not use it for medical, clinical diagnosis or treatment, food and cosmetics, etc. Do not store them in ordinary residential areas.
2. For your safety and health, please wear laboratory clothes, disposable gloves and masks.
3. The experimental results may be affected by many factors, after-sale service is limited to the product itself and does not involve other compensation.
Sorry, there is no experimental images.
Sorry, there is no more information.
Sorry, there is no more information.