{{cart_num}}
My CartCAS：123997-18-2
Molecular Formula：C187H270N48O43
Molecular Weight：3878.44
Purity：≥95.0%
Appearance：Lyophilized powder
Storage：Store at -20℃，2 years.(Avoid freeze/thaw cycles)
Qty：
Size：
| Product Type | Peptides |
| CAS | 123997-18-2 |
| Sequence(1LC) | YVPLPNVPQPGRRPFPTFPGQGPFNPKIKWPQGY |
| Sequence(3LC) | Tyr-Val-Pro-Leu-Pro-Asn-Val-Pro-Gln-Pro-Gly-Arg-Arg-Pro-Phe-Pro-Thr-Phe-Pro-Gly-Gln-Gly-Pro-Phe-Asn-Pro-Lys-Ile-Lys-Trp-Pro-Gln-Gly-Tyr |
| Molecular Formula | C187H270N48O43 |
| Molecular Weight | 3878.44 |
| Purity | ≥95.0% |
| Appearance | Lyophilized powder |
| Solubility | Neuropeptide Y (3-36) (porcine) (0.24-24 nM; i.c.v.; single dose) induces feeding in the rat in a dose-dependent manner[1]. Neuropeptide Y (3-36) (porcine) (4 μg， 8 μg; i.c.v.; single dose) significantly increased food intake at 2 and 3 h， results dose-dependently orexigenic effect in rainbow trout (Oncorhynchus mykiss). |
| Salt Form | Trifluoroacetate salt |
| Source | Synthetic |
| Storage | Store at -20℃，2 years.(Avoid freeze/thaw cycles) |
| Category/Label | Antimicrobial Peptides |
| Background | Abaecin is an antibacterial response peptide. Abaecin shows specific activity against an Apidaecin-resistant Xanthomonas strain. |
| Reference | [1]. Casteels P， et， al. Isolation and characterization of abaecin， a major antibacterial response peptide in the honeybee (Apis mellifera). Eur J Biochem. 1990 Jan 26;187(2):381-6. |
| Unit | Bottle |
| Specification | 1mg 5mg |
Remark：These protocols are for reference only. Solarbio does not independently validate these methods.
Note：
1. The products are all for scientific research use only. Do not use it for medical, clinical diagnosis or treatment, food and cosmetics, etc. Do not store them in ordinary residential areas.
2. For your safety and health, please wear laboratory clothes, disposable gloves and masks.
3. The experimental results may be affected by many factors, after-sale service is limited to the product itself and does not involve other compensation.
Sorry, there is no experimental images.
Sorry, there is no more information.
Sorry, there is no more information.
Manual Download
