{{cart_num}}
My Cart> Peptides > Hormone and Related Peptides > Prolactin-Releasing Peptide (1-31), bovineMolecular Formula：C157H244N54O41S1
Molecular Weight：3576.07
Purity：≥95%
Appearance：Lyophilized powder
Storage：Store at -20℃，2 years.(Avoid freeze/thaw cycles)
Qty：
Size：
| Product Type | Peptides |
| Sequence(1LC) | SRAHQHSMEIRTPDINPAWYAGRGIRPVGRF-NH2 |
| Sequence(3LC) | Ser-Arg-Ala-His-Gln-His-Ser-Met-Glu-Ile-Arg-Thr-Pro-Asp-Ile-Asn-Pro-Ala-Trp-Tyr-Ala-Gly-Arg-Gly-Ile-Arg-Pro-Val-Gly-Arg-Phe-NH2 |
| Molecular Formula | C157H244N54O41S1 |
| Molecular Weight | 3576.07 |
| Purity | ≥95% |
| Appearance | Lyophilized powder |
| Salt Form | Trifluoroacetate salt |
| Source | Synthetic |
| Storage | Store at -20℃，2 years.(Avoid freeze/thaw cycles) |
| Category/Label | Hormone and Related Peptides |
| Background | Prolactin-Releasing Peptide (1-31), bovine is a fragment of the prolactin releasing peptide (PrRP). |
| Reference | [1] achibana T, et al. Functions of two distinct 'prolactin-releasing peptides' evolved from a common ancestral gene. Front Endocrinol (Lausanne). 2014 Nov 10;5:170. |
| Unit | Bottle |
| Specification | 1mg 5mg |
Remark：These protocols are for reference only. Solarbio does not independently validate these methods.
Note：
1. The products are all for scientific research use only. Do not use it for medical, clinical diagnosis or treatment, food and cosmetics, etc. Do not store them in ordinary residential areas.
2. For your safety and health, please wear laboratory clothes, disposable gloves and masks.
3. The experimental results may be affected by many factors, after-sale service is limited to the product itself and does not involve other compensation.
Sorry, there is no experimental images.
Sorry, there is no more information.
Sorry, there is no more information.
Manual Download
