PHI-27 (porcine)
Cat.No:CLP1584 Solarbio
CAS:80458-29-3
Molecular Formula:C136H216N36O40
Molecular Weight:2995.39
Purity:≥95%
Appearance:Lyophilized powder
Storage:Store at -20℃,2 years.(Avoid freeze/thaw cycles)
Qty:
Size:
{{cart_num}}
My CartCAS:80458-29-3
Molecular Formula:C136H216N36O40
Molecular Weight:2995.39
Purity:≥95%
Appearance:Lyophilized powder
Storage:Store at -20℃,2 years.(Avoid freeze/thaw cycles)
Qty:
Size:
Product Type | Peptides |
CAS | 80458-29-3 |
Sequence(1LC) | HADGVFTSDFSRLLGQLSAKKYLESLI-NH2 |
Sequence(3LC) | His-Ala-Asp-Gly-Val-Phe-Thr-Ser-Asp-Phe-Ser-Arg-Leu-Leu-Gly-Gln-Leu-Ser-Ala-Lys-Lys-Tyr-Leu-Glu-Ser-Leu-Ile-NH2 |
Molecular Formula | C136H216N36O40 |
Molecular Weight | 2995.39 |
Purity | ≥95% |
Appearance | Lyophilized powder |
Salt Form | Trifluoroacetate salt |
Source | Synthetic |
Storage | Store at -20℃,2 years.(Avoid freeze/thaw cycles) |
Category/Label | Hormone and Related Peptides |
Background | PHI-27 (porcine) is a 27 amino acid peptide.PHI-27 (porcine) is used to find peptide hormones and other active peptides. |
Reference | [1]. Tatemoto K, et, al. Isolation and characterization of the intestinal peptide porcine PHI (PHI-27), a new member of the glucagon--secretin family. Proc Natl Acad Sci U S A. 1981 Nov;78(11):6603-7. |
Unit | Bottle |
Specification | 1mg 5mg |
Remark:These protocols are for reference only. Solarbio does not independently validate these methods.
Note:
1. The products are all for scientific research use only. Do not use it for medical, clinical diagnosis or treatment, food and cosmetics, etc. Do not store them in ordinary residential areas.
2. For your safety and health, please wear laboratory clothes, disposable gloves and masks.
3. The experimental results may be affected by many factors, after-sale service is limited to the product itself and does not involve other compensation.
Sorry, there is no more information.
Sorry, there is no more information.