{{cart_num}}
My Cart> Peptides > Hormone and Related Peptides > Prolactin-Releasing Peptide (1-31), humanCAS：215510-22-8
Molecular Formula：C160H252N56O42S1
Molecular Weight：3664.18
Purity：≥95%
Appearance：Lyophilized powder
Storage：Store at -20℃，2 years.(Avoid freeze/thaw cycles)
Qty：
Size：
| Product Type | Peptides |
| CAS | 215510-22-8 |
| Sequence(1LC) | SRTHRHSMEIRTPDINPAWYASRGIRPVGRF-NH2 |
| Sequence(3LC) | Ser-Arg-Thr-His-Arg-His-Ser-Met-Glu-Ile-Arg-Thr-Pro-Asp-Ile-Asn-Pro-Ala-Trp-Tyr-Ala-Ser-Arg-Gly-Ile-Arg-Pro-Val-Gly-Arg-Phe-NH2 |
| Molecular Formula | C160H252N56O42S1 |
| Molecular Weight | 3664.18 |
| Purity | ≥95% |
| Appearance | Lyophilized powder |
| Solubility | DMSO：12.5 mg/mL; *Ultrasonic solubilization; |
| Salt Form | Trifluoroacetate salt |
| Source | Synthetic |
| Storage | Store at -20℃，2 years.(Avoid freeze/thaw cycles) |
| Category/Label | Hormone and Related Peptides |
| Background | Prolactin Releasing Peptide (1-31), human is a high affinity GPR10 ligand that cause the release of the prolactin. Human and rat Prolactin Releasing Peptide (1-31) binds to GPR10 with Kis of 1.03 and 0.33 nM, respectively. |
| Reference | [1] Langmead CJ, et al. Characterization of the binding of [(125)I]-human prolactin releasing peptide (PrRP) to GPR10, a novel G protein coupled receptor. Characterization of the binding of [(125)I]-human prolactin releasing peptide (PrRP) to GPR10, a novel G protein coupled receptor. |
| Unit | Bottle |
| Specification | 1mg 5mg |
Remark：These protocols are for reference only. Solarbio does not independently validate these methods.
Note：
1. The products are all for scientific research use only. Do not use it for medical, clinical diagnosis or treatment, food and cosmetics, etc. Do not store them in ordinary residential areas.
2. For your safety and health, please wear laboratory clothes, disposable gloves and masks.
3. The experimental results may be affected by many factors, after-sale service is limited to the product itself and does not involve other compensation.
Sorry, there is no experimental images.
Sorry, there is no more information.
Sorry, there is no more information.
Manual Download
